Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP6 Rabbit Polyclonal Antibody (HRP)

GBP6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZN66

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GBP6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLCSTFVYN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_940862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

bcl 6 (BCL6) (NM_001706) Human Over-expression Lysate
LY400639 100 µg

bcl 6 (BCL6) (NM_001706) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Lung: left upper lobe
CR562492 5 µg

Tissue Total RNA, Lung: left upper lobe

Sign In for Pricing
View Details
Human Interleukin 21 (IL21) ELISA Kit
RD-IL21-Hu-01 96 Tests

Human Interleukin 21 (IL21) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 21 (IL21) ELISA Kit
RD-IL21-Hu-02 48 Tests

Human Interleukin 21 (IL21) ELISA Kit

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), 0.2mg/mL
BNUB1073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), 0.2mg/mL

Sign In for Pricing
View Details
Muted (BLOC1S5) (NM_201280) Human Recombinant Protein
TP321922 20 µg

Muted (BLOC1S5) (NM_201280) Human Recombinant Protein

Sign In for Pricing
View Details