Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR173 Rabbit Polyclonal Antibody (Biotin)

GPR173 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SREB3

UniProt

Q9NS66

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR173

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061842

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB607566 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
CK-MM Antigen
orb372177 100 µg

CK-MM Antigen

Sign In for Pricing
View Details
Human Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) ELISA Kit
MBS4500772-01 48 Tests

Human Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) ELISA Kit

Sign In for Pricing
View Details
Human Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) ELISA Kit
MBS4500772-02 96 Tests

Human Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) ELISA Kit

Sign In for Pricing
View Details
Human Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) ELISA Kit
MBS4500772-03 5x 96 Tests

Human Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) ELISA Kit

Sign In for Pricing
View Details
Human Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) ELISA Kit
MBS4500772-04 10x 96 Tests

Human Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3) ELISA Kit

Sign In for Pricing
View Details