Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B13 Rabbit Polyclonal Antibody (HRP)

HSD17B13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCDR9, NIIL497, SDR16C3, HMFN0376

UniProt

Q7Z5P4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HSD17B13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_835236

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTFR Protein Vector (Mouse) (pPB-C-His)
PV166842 500 ng

CNTFR Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
2-Chloroinosine (2-CIDO)
MBS6028555-01 100 mg

2-Chloroinosine (2-CIDO)

Sign In for Pricing
View Details
2-Chloroinosine (2-CIDO)
MBS6028555-02 5x 100 mg

2-Chloroinosine (2-CIDO)

Sign In for Pricing
View Details
Ms4a10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6603308 1.0 µg DNA

Ms4a10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
HOXB1 Antibody
22-357 100 µL

HOXB1 Antibody

Sign In for Pricing
View Details
ACVR2B (Activin Receptor Type 2B, Activin Receptor Type IIB, ACTR-IIB)
139064 200 µL

ACVR2B (Activin Receptor Type 2B, Activin Receptor Type IIB, ACTR-IIB)

Sign In for Pricing
View Details