Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IBA57 Rabbit Polyclonal Antibody (FITC)

IBA57 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MMDS3, SPG74, C1orf69

UniProt

Q5T440

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IBA57

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVW

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001010867

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANBP1 (Ran-specific GTPase-activating Protein, Ran-binding Protein 1, RanBP1) (MaxLight 550)
MBS6391986-01 0.1 mL

RANBP1 (Ran-specific GTPase-activating Protein, Ran-binding Protein 1, RanBP1) (MaxLight 550)

Sign In for Pricing
View Details
RANBP1 (Ran-specific GTPase-activating Protein, Ran-binding Protein 1, RanBP1) (MaxLight 550)
MBS6391986-02 5x 0.1 mL

RANBP1 (Ran-specific GTPase-activating Protein, Ran-binding Protein 1, RanBP1) (MaxLight 550)

Sign In for Pricing
View Details
CDSN sgRNA CRISPR Lentivector (Human) (Target 1)
K0423102 1.0 µg DNA

CDSN sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Brain Natriuretic Peptide (Brain Natriuretic Peptide 32, BNP 32, Gamma Brain Natriuretic Peptide, Natriuretic Peptide Brain Type, Natriuretic Peptide Precursor B, Natriuretic Peptides B, NPPB Protein) (MaxLight 650) discontinued
B2702-29U-ML650 100 µL

Brain Natriuretic Peptide (Brain Natriuretic Peptide 32, BNP 32, Gamma Brain Natriuretic Peptide, Natriuretic Peptide Brain Type, Natriuretic Peptide Precursor B, Natriuretic Peptides B, NPPB Protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Acp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4008507 1.0 µg DNA

Acp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Gloeobacter violaceus Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1335426-01 0.02 mg (E-Coli)

Recombinant Gloeobacter violaceus Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details