Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD2 Rabbit Polyclonal Antibody (FITC)

KCTD2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q14681

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCTD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVRLVKERIRDNENRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056168

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Junctional adhesion molecule-like, AMICA1 ELISA KIT
ELI-19682h 96 Tests

Human Junctional adhesion molecule-like, AMICA1 ELISA KIT

Sign In for Pricing
View Details
BCAR1 Protein Lysate (Rat) with C-HA Tag
13204036 100 µg

BCAR1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Human NCSTN Protein, N-His
E55P2796 50 µg

Recombinant Human NCSTN Protein, N-His

Sign In for Pricing
View Details
Lentiviral human IL18RAP sgRNA gene knockout kit - Lentiviral human IL18RAP sgRNA gene knockout kit (plasmid)
GTR15354724 1 Vial

Lentiviral human IL18RAP sgRNA gene knockout kit - Lentiviral human IL18RAP sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Histone H3 Mouse Monoclonal Antibody (2D10)
A01070A555 100 µL

Histone H3 Mouse Monoclonal Antibody (2D10)

Sign In for Pricing
View Details
ADH7 Antibody
A11293-50UG 50 µg

ADH7 Antibody

Sign In for Pricing
View Details