Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0556 Rabbit Polyclonal Antibody (HRP)

KIAA0556 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JBTS26, KIAA0556

UniProt

O60303

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIAA0556

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTEAGPRLHIEPPVDYSDDFELCGDVTLQANNTSEDRPQELRRSLELSVN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

178kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_056017

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moxd2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3611603 1.0 µg DNA

Moxd2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit
MBS905200-01 24 Well (LIMIT 1)

Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit

Sign In for Pricing
View Details
Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit
MBS905200-02 48 Well

Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit

Sign In for Pricing
View Details
Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit
MBS905200-03 96 Well

Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit

Sign In for Pricing
View Details
Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit
MBS905200-04 5x 96 Well

Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit

Sign In for Pricing
View Details
Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit
MBS905200-05 10x 96 Well

Mouse ADAMTS-like protein 4, ADAMTSL4 ELISA Kit

Sign In for Pricing
View Details