Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT38 Rabbit Polyclonal Antibody (HRP)

KRT38 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HA8, hHa8, KRTHA8

UniProt

O76015

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KRT38

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERSKCH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_006762

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Growth Differentiation Factor 5 ELISA Kit
MBS105260-01 48 Well

Camel Growth Differentiation Factor 5 ELISA Kit

Sign In for Pricing
View Details
Camel Growth Differentiation Factor 5 ELISA Kit
MBS105260-02 96 Well

Camel Growth Differentiation Factor 5 ELISA Kit

Sign In for Pricing
View Details
Camel Growth Differentiation Factor 5 ELISA Kit
MBS105260-03 5x 96 Well

Camel Growth Differentiation Factor 5 ELISA Kit

Sign In for Pricing
View Details
Camel Growth Differentiation Factor 5 ELISA Kit
MBS105260-04 10x 96 Well

Camel Growth Differentiation Factor 5 ELISA Kit

Sign In for Pricing
View Details
InVivoMAb Anti-HPV58 L1/Major capsid protein L1 (Iv0004)
MBS1570034-01 0.1 mg

InVivoMAb Anti-HPV58 L1/Major capsid protein L1 (Iv0004)

Sign In for Pricing
View Details
InVivoMAb Anti-HPV58 L1/Major capsid protein L1 (Iv0004)
MBS1570034-02 1 mg

InVivoMAb Anti-HPV58 L1/Major capsid protein L1 (Iv0004)

Sign In for Pricing
View Details