Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT73 Rabbit Polyclonal Antibody (HRP)

KRT73 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K73, CK-73, K6IRS3, IRT6IRS3, KRT6IRS3

UniProt

Q86Y46

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT73

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLALSSPTKKTMR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_778238

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF606 Antibody (N-term) Blocking Peptide
MBS9222980-01 0.5 mg

ZNF606 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
ZNF606 Antibody (N-term) Blocking Peptide
MBS9222980-02 5x 0.5 mg

ZNF606 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
PKC delta Rabbit Polyclonal Antibody (Biotin)
orb447377 100 µL

PKC delta Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Bcl2l1 AAV siRNA Pooled Vector
13231164 1.0 µg

Bcl2l1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 1G1 (OR1G1), partial
MBS7112174 Inquire

Recombinant Human Olfactory receptor 1G1 (OR1G1), partial

Sign In for Pricing
View Details
CDYL (Chromodomain Y-like Protein, CDY-like, CDYL1, DKFZp586C1622, DKFZP586C1622, MGC131936) (APC)
124821-APC 100 µL

CDYL (Chromodomain Y-like Protein, CDY-like, CDYL1, DKFZp586C1622, DKFZP586C1622, MGC131936) (APC)

Sign In for Pricing
View Details