Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT80 Rabbit Polyclonal Antibody (Biotin)

KRT80 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KB20

UniProt

Q6KB66

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KRT80

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001074961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RING finger and transmembrane domain-containing protein 2, RNFT2 ELISA Kit
MBS9323136-01 48 Well

Mouse RING finger and transmembrane domain-containing protein 2, RNFT2 ELISA Kit

Sign In for Pricing
View Details
Mouse RING finger and transmembrane domain-containing protein 2, RNFT2 ELISA Kit
MBS9323136-02 96 Well

Mouse RING finger and transmembrane domain-containing protein 2, RNFT2 ELISA Kit

Sign In for Pricing
View Details
Mouse RING finger and transmembrane domain-containing protein 2, RNFT2 ELISA Kit
MBS9323136-03 5x 96 Well

Mouse RING finger and transmembrane domain-containing protein 2, RNFT2 ELISA Kit

Sign In for Pricing
View Details
Mouse RING finger and transmembrane domain-containing protein 2, RNFT2 ELISA Kit
MBS9323136-04 10x 96 Well

Mouse RING finger and transmembrane domain-containing protein 2, RNFT2 ELISA Kit

Sign In for Pricing
View Details
Lipopolysaccharide Binding Protein (LBP, LPSBP)
L2525-25B 100 µg

Lipopolysaccharide Binding Protein (LBP, LPSBP)

Sign In for Pricing
View Details
ECH1 siRNA (Rat)
CRR1928-01 15 nmol

ECH1 siRNA (Rat)

Sign In for Pricing
View Details