Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIN54 Rabbit Polyclonal Antibody (HRP)

LIN54 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TCX1, JC8.6, CXCDC1, MIP120

UniProt

Q6MZP7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LIN54

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSIC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001108479

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10R2 Antibody
E19-5183 100 µg -100 µL

OR10R2 Antibody

Sign In for Pricing
View Details
ATP Binding Cassette Transporter A9 (ABCA9), Recombinant, Mouse, His-Tag
049875-01 10 µg

ATP Binding Cassette Transporter A9 (ABCA9), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
ATP Binding Cassette Transporter A9 (ABCA9), Recombinant, Mouse, His-Tag
049875-02 50 µg

ATP Binding Cassette Transporter A9 (ABCA9), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
ATP Binding Cassette Transporter A9 (ABCA9), Recombinant, Mouse, His-Tag
049875-03 100 µg

ATP Binding Cassette Transporter A9 (ABCA9), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
ATP Binding Cassette Transporter A9 (ABCA9), Recombinant, Mouse, His-Tag
049875-04 200 µg

ATP Binding Cassette Transporter A9 (ABCA9), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Multiplex Assay Kit for Bilirubin (Bb), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031640 96 Tests

Multiplex Assay Kit for Bilirubin (Bb), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details