Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spcs2 Rabbit Polyclonal Antibody (Biotin)

Spcs2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1311253

UniProt

D3ZD11

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Spcs2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GTSSSRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001178530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASC2 (PYDC1) Mouse Monoclonal Antibody [Clone ID: OTI1A4]
TA803570S 30 µL

ASC2 (PYDC1) Mouse Monoclonal Antibody [Clone ID: OTI1A4]

Sign In for Pricing
View Details
MS4A2 (NM_000139) Human Over-expression Lysate
LS002206-100ug 100 µg

MS4A2 (NM_000139) Human Over-expression Lysate

Sign In for Pricing
View Details
GABRG2 Human Pre-designed siRNA Set A
HY-RS05221 1 Set

GABRG2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
MEN1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1290303 1.0 µg DNA

MEN1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
NOTCH1, CT (Notch 1 homolog, Notch homolog 1, Notch homolog-1, Notch 1) (MaxLight 405)
MBS6453021-01 0.1 mL

NOTCH1, CT (Notch 1 homolog, Notch homolog 1, Notch homolog-1, Notch 1) (MaxLight 405)

Sign In for Pricing
View Details
NOTCH1, CT (Notch 1 homolog, Notch homolog 1, Notch homolog-1, Notch 1) (MaxLight 405)
MBS6453021-02 5x 0.1 mL

NOTCH1, CT (Notch 1 homolog, Notch homolog 1, Notch homolog-1, Notch 1) (MaxLight 405)

Sign In for Pricing
View Details