Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3G Rabbit Polyclonal Antibody (HRP)

POLR3G Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C31, RPC7, RPC32

UniProt

O15318

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human POLR3G

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurora B (Proliferation Marker) (AURKB/1592), CF568 conjugate, 0.1mg/mL
BNC681592-100 1x 100 µL

Aurora B (Proliferation Marker) (AURKB/1592), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 Mouse Monoclonal Antibody [Clone ID: EQ-8D11-C1]
AM32448PU-N 100 µg

CD34 Mouse Monoclonal Antibody [Clone ID: EQ-8D11-C1]

Sign In for Pricing
View Details
ANP32C Mouse Monoclonal Antibody [Clone ID: OTI10A10]
CF809613 100 µg

ANP32C Mouse Monoclonal Antibody [Clone ID: OTI10A10]

Sign In for Pricing
View Details
p15 INK4b (CDKN2B) Human Gene Knockout Kit (CRISPR)
KN204895BN 1 Kit

p15 INK4b (CDKN2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VC 50bp DNA Ladder (ready-to-use), 5 x 50µg
NL1424 5 x 50μg

VC 50bp DNA Ladder (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI6A2]
TA813780S 30 µL

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: OTI6A2]

Sign In for Pricing
View Details