Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5I1 Rabbit Polyclonal Antibody (HRP)

OR5I1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OLF1, HSOlf1

UniProt

Q13606

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5I1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SYLYSPNTDKIISVFYTIFIPVLNPLIYSLRNKDVKDAAEKVLRSKVDSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_006628

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine F7 (Coagulation Factor VII) ValidElisa Kit
EK344344 96 Well

Porcine F7 (Coagulation Factor VII) ValidElisa Kit

Sign In for Pricing
View Details
JNK2 Mouse mAb
E2222389 100 µL

JNK2 Mouse mAb

Sign In for Pricing
View Details
Proadrenomedullin (Pro-ADM) Horse ELISA Kit
G0927 96 Tests

Proadrenomedullin (Pro-ADM) Horse ELISA Kit

Sign In for Pricing
View Details
Gm15299 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
21905114 3x 1.0 µg

Gm15299 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human ZNG1F qPCR Primer Pair
QH80485S 200 Tests

Human ZNG1F qPCR Primer Pair

Sign In for Pricing
View Details
GRK7 (G Protein-Coupled Receptor Kinase 7, GPRK7, G-Protein-Coupled Receptor Kinase 7) (MaxLight 490)
MBS6204823-01 0.1 mL

GRK7 (G Protein-Coupled Receptor Kinase 7, GPRK7, G-Protein-Coupled Receptor Kinase 7) (MaxLight 490)

Sign In for Pricing
View Details