Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENTR1 Rabbit Polyclonal Antibody (HRP)

ENTR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SDDAG3, NY-CO-3, SDCCAG3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SDCCAG3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006634

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Streptavidin High Binding Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MGSTDF-SB75/100 10x 96 Well Plates

Streptavidin High Binding Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS622741 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702046 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
FMO3 Rabbit Polyclonal Antibody
TA384241 100 µL

FMO3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), CF®568 Conjugate - Biotium Choice
P015-568-125 1x 125 µL

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), CF®568 Conjugate - Biotium Choice

Sign In for Pricing
View Details
RHOA Rabbit Polyclonal Antibody
AP06618PU-N 100 µg

RHOA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details