Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZC3H13 Rabbit Polyclonal Antibody (Biotin)

ZC3H13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Xio, KIAA0853

UniProt

Q5T200

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZC3H13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GSGAGEGYEPISDDELDEILAGDAEKREDQQDEEKMPDPLDVIDVDWSGL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

172kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_055885

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcein AM Solution, 2 mM in DMSO (0.5 mL)
1074 2 mM in DMSO 0.5 mL

Calcein AM Solution, 2 mM in DMSO (0.5 mL)

Sign In for Pricing
View Details
EIF5AL1 (C-term) Rabbit Polyclonal Antibody
AP51404PU-N 400 µL

EIF5AL1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPK15 Rabbit Polyclonal Antibody
AP20502PU-N 100 µg

MAPK15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2R,3S-Dihydroxy-4-oxo-butanoic Acid (>80%)
TRC-D450800-10MG 10 mg

2R,3S-Dihydroxy-4-oxo-butanoic Acid (>80%)

Sign In for Pricing
View Details
MADM (NRBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]
TA500449AM 100 µL

MADM (NRBP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF647 conjugate, 0.1mg/mL
BNC472034-100 1x 100 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details