Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZC3H13 Rabbit Polyclonal Antibody (FITC)

ZC3H13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Xio, KIAA0853

UniProt

Q5T200

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZC3H13

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GSGAGEGYEPISDDELDEILAGDAEKREDQQDEEKMPDPLDVIDVDWSGL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

172kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_055885

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MGP Antibody (OTI11G6) [Alexa Fluor 700]
NBP2-72660AF700 0.1 mL

Mouse Monoclonal MGP Antibody (OTI11G6) [Alexa Fluor 700]

Sign In for Pricing
View Details
C. Perfringens NA Protein (N-His, C.perfringens)
P522489 100 µg

C. Perfringens NA Protein (N-His, C.perfringens)

Sign In for Pricing
View Details
KD-Validated Anti-CHMP5 Mouse Monoclonal Antibody
AGI2018-100 100 µL

KD-Validated Anti-CHMP5 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Telomerase, Control Peptide (TP1, p80 Telomerase Homolog, Telomerase-Associated Protein 1, Telomerase Protein 1, Telomerase Protein Component 1)
146916 50 µg

Telomerase, Control Peptide (TP1, p80 Telomerase Homolog, Telomerase-Associated Protein 1, Telomerase Protein 1, Telomerase Protein Component 1)

Sign In for Pricing
View Details
GPR108 CRISPR/Cas9 KO Plasmid (h)
sc-407669 20 µg

GPR108 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
RP23 Recombinant Protein (Human)
RP089763 100 µg

RP23 Recombinant Protein (Human)

Sign In for Pricing
View Details