Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POTEH Rabbit Polyclonal Antibody (HRP)

POTEH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A26C3, ACTBL1, POTE22, CT104.7

UniProt

Q6S545

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human POTEH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMKKHGSTHMGFPENL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001129685

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PAI-1 Antibody, Mouse Monoclonal
MBS8102151-01 0.02 mL

Anti-PAI-1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-PAI-1 Antibody, Mouse Monoclonal
MBS8102151-02 0.1 mL

Anti-PAI-1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-PAI-1 Antibody, Mouse Monoclonal
MBS8102151-03 5x 0.1 mL

Anti-PAI-1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
TUBGCP6 Protein Vector (Mouse) (pPM-C-HA)
48835024 500 ng

TUBGCP6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TIMM17B Human Over-expression Lysate
orb1346732 100 µg

TIMM17B Human Over-expression Lysate

Sign In for Pricing
View Details
PPP2R5C, CT (PPP2R5C, KIAA0044, Serine/threonine-protein phosphatase 2A 56kD regulatory subunit gamma isoform, PP2A B subunit isoform B'-gamma, PP2A B subunit isoform B56-gamma, PP2A B subunit isoform PR61-gamma, PP2A B subunit isoform R5-gamma, Renal carcinoma antigen NY-REN-29) (AP) discontinued
040356-AP 200 µL

PPP2R5C, CT (PPP2R5C, KIAA0044, Serine/threonine-protein phosphatase 2A 56kD regulatory subunit gamma isoform, PP2A B subunit isoform B'-gamma, PP2A B subunit isoform B56-gamma, PP2A B subunit isoform PR61-gamma, PP2A B subunit isoform R5-gamma, Renal carcinoma antigen NY-REN-29) (AP) discontinued

Sign In for Pricing
View Details