Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR11A1 Rabbit Polyclonal Antibody (HRP)

OR11A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

6M1-18, OR11A2, hs6M1-18, dJ994E9.6

UniProt

Q9GZK7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR11A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQALRKILCIK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_039225

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Borrelia burgdorferi One-Step PCR kit
Oneq-VH024-150D 150 Reactions

Borrelia burgdorferi One-Step PCR kit

Sign In for Pricing
View Details
C12orf66 (NM_001300941) Human Tagged ORF Clone
RG237935 10 µg

C12orf66 (NM_001300941) Human Tagged ORF Clone

Sign In for Pricing
View Details
PTRF 3'UTR GFP Stable Cell Line
TU069241 1.0 mL

PTRF 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-DDX5 Rabbit Monoclonal Antibody
M00670-3-100μl 100 µL

Anti-DDX5 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human LIG3 siRNA
abx922550-01 15 nmol

Human LIG3 siRNA

Sign In for Pricing
View Details
Human LIG3 siRNA
abx922550-02 30 nmol

Human LIG3 siRNA

Sign In for Pricing
View Details