Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MACROD1 Rabbit Polyclonal Antibody (FITC)

MACROD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LRP16

UniProt

Q9BQ69

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MACROD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_054786

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Secondary Lymphoid Tissue Chemokine (SLC)
TRV-0003724-01 20 µL

Polyclonal Antibody to Secondary Lymphoid Tissue Chemokine (SLC)

Sign In for Pricing
View Details
Polyclonal Antibody to Secondary Lymphoid Tissue Chemokine (SLC)
TRV-0003724-02 100 µL

Polyclonal Antibody to Secondary Lymphoid Tissue Chemokine (SLC)

Sign In for Pricing
View Details
Polyclonal Antibody to Secondary Lymphoid Tissue Chemokine (SLC)
TRV-0003724-03 200 µL

Polyclonal Antibody to Secondary Lymphoid Tissue Chemokine (SLC)

Sign In for Pricing
View Details
Polyclonal Antibody to Secondary Lymphoid Tissue Chemokine (SLC)
TRV-0003724-04 1 mL

Polyclonal Antibody to Secondary Lymphoid Tissue Chemokine (SLC)

Sign In for Pricing
View Details
CD45RB (B220, CD45R, GP180, Leukocyte common antigen (LCA), Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C (PTPRC), Receptor-type tyrosine-protein phosphatase C, T200 glycoprotein) (PE)
168697 100 Tests

CD45RB (B220, CD45R, GP180, Leukocyte common antigen (LCA), Loc, Ly-5, Lyt-4, Protein tyrosine phosphatase receptor type C (PTPRC), Receptor-type tyrosine-protein phosphatase C, T200 glycoprotein) (PE)

Sign In for Pricing
View Details
Growth Arrest Specific Protein 7 Rabbit Polyclonal Antibody (BF750)
orb2419560 100 µL

Growth Arrest Specific Protein 7 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details