Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RMC1 Rabbit Polyclonal Antibody (HRP)

RMC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIC1, Mic-1, WDR98, C18orf8, HsT2591

UniProt

Q96DM3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human C18ORF8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVVVKGPDDRNPISFRMDDKGEVKCIKFSLENKILAVQRTSKTVDFCNFI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037458.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB13 (NM_153614) Human Recombinant Protein
TP314119 20 µg

DNAJB13 (NM_153614) Human Recombinant Protein

Sign In for Pricing
View Details
Polystyrene AM NH₂
H40045002.100G 100 g

Polystyrene AM NH₂

Sign In for Pricing
View Details
CD40 Mouse Monoclonal Antibody [Clone ID: OTI8G5]
CF807572 100 µg

CD40 Mouse Monoclonal Antibody [Clone ID: OTI8G5]

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (CD44V6/2496), 0.2mg/mL
BNUB2496-500 1x 500 µL

CD44v6 (Marker of Tumor Metastasis) (CD44V6/2496), 0.2mg/mL

Sign In for Pricing
View Details
PTPRB Mouse Monoclonal Antibody [2-A2]
M1406-1 100 µL

PTPRB Mouse Monoclonal Antibody [2-A2]

Sign In for Pricing
View Details
ZFP200 (ZNF200) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F10]
TA808214BM 100 µL

ZFP200 (ZNF200) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6F10]

Sign In for Pricing
View Details