Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP15 Rabbit Polyclonal Antibody (Biotin)

RRP15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CGI-115, KIAA0507

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRP15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_057136

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THTPA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C11]
TA806180BM 100 µL

THTPA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C11]

Sign In for Pricing
View Details
Hsa-miR-4755-3p miRNA Inhibitor
CIH1629-01 10 nmol

Hsa-miR-4755-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4755-3p miRNA Inhibitor
CIH1629-02 20 nmol

Hsa-miR-4755-3p miRNA Inhibitor

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), 0.2mg/mL
BNUB2475-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), 0.2mg/mL

Sign In for Pricing
View Details
PDHB Knockout jurkat Polyclonal Cells
ARG13016 1 Million

PDHB Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
SHB CRISPR Knock Out 293T Cell Line (Human)
43697141 1x 10^6 Cells / 1.0 mL

SHB CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details