Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP15 Rabbit Polyclonal Antibody (HRP)

RRP15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI-115, KIAA0507

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRP15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_057136

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM25A (NM_001146157) Human Over-expression Lysate
LC431745 20 µg

FAM25A (NM_001146157) Human Over-expression Lysate

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS4), CF405S conjugate, 0.1mg/mL
BNC041744-100 1x 100 µL

Epstein-Barr Virus (LMP-1) (CS4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF647 conjugate, 0.1mg/mL
BNC471143-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Caspase-2 Antibody
RC-6934-01 50 μL

Recombinant Caspase-2 Antibody

Sign In for Pricing
View Details
Recombinant Caspase-2 Antibody
RC-6934-02 100 µL

Recombinant Caspase-2 Antibody

Sign In for Pricing
View Details
Recombinant Caspase-2 Antibody
RC-6934-03 1 mL

Recombinant Caspase-2 Antibody

Sign In for Pricing
View Details