Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf32 Rabbit Polyclonal Antibody (HRP)

C3orf32 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SSU-2, fls485, C3orf32

UniProt

F5H2S5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C3orf32

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRYKCSGCHGAGTVRCPSCCGAKRKAKQSRRCQLCAGSGRRRCSTCSGRG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001243677

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ikzf1 Mouse shRNA Plasmid (Locus ID 22778)
TR502473 1 Kit

Ikzf1 Mouse shRNA Plasmid (Locus ID 22778)

Sign In for Pricing
View Details
CD10 Antibody
ASA-B0340 1 Each

CD10 Antibody

Sign In for Pricing
View Details
MAGEA4 Human Gene Knockout Kit (CRISPR)
KN204482 1 Kit

MAGEA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CD5 Antigen Like Protein (CD5L) ELISA Kit
BSKH66009-01 48 Tests

Human CD5 Antigen Like Protein (CD5L) ELISA Kit

Sign In for Pricing
View Details
Human CD5 Antigen Like Protein (CD5L) ELISA Kit
BSKH66009-02 96 Tests

Human CD5 Antigen Like Protein (CD5L) ELISA Kit

Sign In for Pricing
View Details
Mouse Leptin (LEP) Mini Samples ELISA Kit
MBS2087234-01 24 Strip Well

Mouse Leptin (LEP) Mini Samples ELISA Kit

Sign In for Pricing
View Details