Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NT5DC3 Rabbit Polyclonal Antibody (HRP)

NT5DC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TU12B1TY, TU12B1-TY

UniProt

Q86UY8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NT5DC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AARGRPCAGPARPLCTAPGTAPDMKRYLWERYREAKRSTEELVPSIMSNL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001026871

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0041773-01 24 Tests

ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0041773-02 48 Tests

ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0041773-03 96 Tests

ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0041773-04 5x 96 Tests

ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)
TRV-0041773-05 10x 96 Tests

ELISA Kit for Tight Junction Associated Protein 1, Peripheral (TJAP1)

Sign In for Pricing
View Details
SPAG9 Protein Vector (Mouse) (pPB-C-His)
PV233002 500 ng

SPAG9 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details