Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D4 Rabbit Polyclonal Antibody (HRP)

UBE2D4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HBUCE1

UniProt

Q9UQL0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human UBE2D4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_011513724.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit
MBS7244606-01 48 Well

Canine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit

Sign In for Pricing
View Details
Canine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit
MBS7244606-02 96 Well

Canine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit

Sign In for Pricing
View Details
Canine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit
MBS7244606-03 5x 96 Well

Canine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit

Sign In for Pricing
View Details
Canine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit
MBS7244606-04 10x 96 Well

Canine Ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1) ELISA Kit

Sign In for Pricing
View Details
AF10 Rabbit pAb, Pacific Blue conjugated
orb2864346 100 µL

AF10 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Cas9 Expressing U-87 MG Cell Line
T3259 1x106 cells / 1.0 mL

Cas9 Expressing U-87 MG Cell Line

Sign In for Pricing
View Details