Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT17 Rabbit Polyclonal Antibody (Biotin)

SYT17 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Syt-17, sytXVII

UniProt

Q9BSW7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SYT17

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057608

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF488A conjugate, 0.1mg/mL
BNC882448-500 1x 500 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2448), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857), CF405S conjugate, 0.1mg/mL
BNC040857-100 1x 100 µL

WT1 (Wilm's Tumor 1) (WT1/857), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD137 (TNFRSF9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12F12]
TA813097AM 100 µL

CD137 (TNFRSF9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12F12]

Sign In for Pricing
View Details
Tmem9 (NM_025439) Mouse Tagged ORF Clone
MG201678 10 µg

Tmem9 (NM_025439) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ENTPD8 Human Gene Knockout Kit (CRISPR)
KN418598 1 Kit

ENTPD8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WWOX Antibody
KC-28813-01 50 μL

WWOX Antibody

Sign In for Pricing
View Details