Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD16 Rabbit Polyclonal Antibody (FITC)

ANKRD16 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6P6B7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD16

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Immunoglobulin D IgD ELISA Kit
BG-RAT11339 1 Each

Rat Immunoglobulin D IgD ELISA Kit

Sign In for Pricing
View Details
Anti-Human CD62E/SELE Antibody (ENA2), PE
MBS1583494-01 50 Tests

Anti-Human CD62E/SELE Antibody (ENA2), PE

Sign In for Pricing
View Details
Anti-Human CD62E/SELE Antibody (ENA2), PE
MBS1583494-02 100 Tests

Anti-Human CD62E/SELE Antibody (ENA2), PE

Sign In for Pricing
View Details
Anti-Human CD62E/SELE Antibody (ENA2), PE
MBS1583494-03 5x 100 Tests

Anti-Human CD62E/SELE Antibody (ENA2), PE

Sign In for Pricing
View Details
Polyclonal Antibody to Tumor Necrosis Factor Alpha Induced Protein 3 (TNFaIP3)
MBS2025990-01 0.1 mL

Polyclonal Antibody to Tumor Necrosis Factor Alpha Induced Protein 3 (TNFaIP3)

Sign In for Pricing
View Details
Polyclonal Antibody to Tumor Necrosis Factor Alpha Induced Protein 3 (TNFaIP3)
MBS2025990-02 0.2 mL

Polyclonal Antibody to Tumor Necrosis Factor Alpha Induced Protein 3 (TNFaIP3)

Sign In for Pricing
View Details