Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KANSL2 Rabbit Polyclonal Antibody (Biotin)

KANSL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NSL2, C12orf41

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KANSL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CSHPRLEGQEFCIKHILEDKNAPFKQCSYISTKNGKRCPNAAPKPEKKDG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cy7 Anti-human CD42b Antibody *HIP1*
104201N2-AAT 500 Tests

PE/Cy7 Anti-human CD42b Antibody *HIP1*

Sign In for Pricing
View Details
HLA-B7 (BB7.1) AC
sc-53304 AC 500 µg/mL - 25% ag

HLA-B7 (BB7.1) AC

Sign In for Pricing
View Details
Recombinant Human VPS4B, His-tagged
VPS4B-3683H 25 µg

Recombinant Human VPS4B, His-tagged

Sign In for Pricing
View Details
Kcnk4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7016005 3x 1.0 µg

Kcnk4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit anti-ANKRD17 Antibody, Affinity Purified
MBS3902131-01 0.01 mg

Rabbit anti-ANKRD17 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ANKRD17 Antibody, Affinity Purified
MBS3902131-02 0.1 mg

Rabbit anti-ANKRD17 Antibody, Affinity Purified

Sign In for Pricing
View Details