Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KANSL2 Rabbit Polyclonal Antibody (FITC)

KANSL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NSL2, C12orf41

UniProt

Q9H9L4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KANSL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PNAAPKPEKKDGVSFCAEHVRRNALALHAQMKKTNPGPVGETLLCQLSSY

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060292.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF740 conjugate, 0.1mg/mL
BNC741506-500 1x 500 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse LIX (Liposaccharide-Induced CXC chemokine) ELISA Kit
E-EL-M1317-01 24 Tests

Mouse LIX (Liposaccharide-Induced CXC chemokine) ELISA Kit

Sign In for Pricing
View Details
Mouse LIX (Liposaccharide-Induced CXC chemokine) ELISA Kit
E-EL-M1317-02 48 Tests

Mouse LIX (Liposaccharide-Induced CXC chemokine) ELISA Kit

Sign In for Pricing
View Details
Mouse LIX (Liposaccharide-Induced CXC chemokine) ELISA Kit
E-EL-M1317-03 96 Tests

Mouse LIX (Liposaccharide-Induced CXC chemokine) ELISA Kit

Sign In for Pricing
View Details
QuantiChrom™ Creatinine Assay Kit
DICT-500 500 Tests

QuantiChrom™ Creatinine Assay Kit

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details