Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCWPW1 Rabbit Polyclonal Antibody (HRP)

ZCWPW1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZCW1

UniProt

Q9H0M4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZCWPW1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FAPPAQKSYSLLPCSPNSPKEETPGISSPETEARISLPKASLKKKEEKAT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta Catenin Recombinant Rabbit monoclonal Antibody
IRS043 100 µL

Beta Catenin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
LASS3 (CERS3) (NM_178842) Human Recombinant Protein
TP305511 20 µg

LASS3 (CERS3) (NM_178842) Human Recombinant Protein

Sign In for Pricing
View Details
CMTM6 Recombinant Rabbit monoclonal Antibody
HA723702 100 µL

CMTM6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse GH Protein (Trx Tag)
PDEM100156-01 20 µg

Recombinant Mouse GH Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse GH Protein (Trx Tag)
PDEM100156-02 100 µg

Recombinant Mouse GH Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse GH Protein (Trx Tag)
PDEM100156-03 500 µg

Recombinant Mouse GH Protein (Trx Tag)

Sign In for Pricing
View Details