Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMAC2 Rabbit Polyclonal Antibody (Biotin)

DMAC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ATP5SL

UniProt

Q9NW81

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATP5SL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060505

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 14/KRT14 Rabbit Polyclonal Antibody (Cy3)
orb2616652 100 µg

Cytokeratin 14/KRT14 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
RBCK1, CT (RanBP-type And C3HC4-type Zinc Finger-containing Protein 1, Ubiquitin Conjugating Enzyme 7 Interacting Protein 3, Hepatitis B Virus X-associated Protein 4, HBV Associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, HOIL-1, RING Finger Protein 54, UBCE7IP3, C20orf18, RNF54, UBCE7IP3, XAP3, XAP4) (AP) discontinued
R1277-01A-AP 200 µL

RBCK1, CT (RanBP-type And C3HC4-type Zinc Finger-containing Protein 1, Ubiquitin Conjugating Enzyme 7 Interacting Protein 3, Hepatitis B Virus X-associated Protein 4, HBV Associated Factor 4, Heme-oxidized IRP2 Ubiquitin Ligase 1, HOIL-1, RING Finger Protein 54, UBCE7IP3, C20orf18, RNF54, UBCE7IP3, XAP3, XAP4) (AP) discontinued

Sign In for Pricing
View Details
PIAS2 Recombinant Antibody, PE Conjugated
bsm-62274R-PE-01 20 µL

PIAS2 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
PIAS2 Recombinant Antibody, PE Conjugated
bsm-62274R-PE-02 100 µL

PIAS2 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
STING (TMEM173) CytoSection
TS408418P5 25 Slides

STING (TMEM173) CytoSection

Sign In for Pricing
View Details
CD8 alpha Rabbit pAb
orb1565605-01 20 ul

CD8 alpha Rabbit pAb

Sign In for Pricing
View Details