Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMAC2 Rabbit Polyclonal Antibody (FITC)

DMAC2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ATP5SL

UniProt

Q9NW81

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATP5SL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060505

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM5 Antibody
E19-7396 100 µg -100 µL

MCM5 Antibody

Sign In for Pricing
View Details
Rabbit Mannma binding protein/mannan binding lectin ELISA Kit
MBS730497-01 48 Well

Rabbit Mannma binding protein/mannan binding lectin ELISA Kit

Sign In for Pricing
View Details
Rabbit Mannma binding protein/mannan binding lectin ELISA Kit
MBS730497-02 96 Well

Rabbit Mannma binding protein/mannan binding lectin ELISA Kit

Sign In for Pricing
View Details
Rabbit Mannma binding protein/mannan binding lectin ELISA Kit
MBS730497-03 5x 96 Well

Rabbit Mannma binding protein/mannan binding lectin ELISA Kit

Sign In for Pricing
View Details
Rabbit Mannma binding protein/mannan binding lectin ELISA Kit
MBS730497-04 10x 96 Well

Rabbit Mannma binding protein/mannan binding lectin ELISA Kit

Sign In for Pricing
View Details
Mucin 1 (MUC1, Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Carcinoma-associated Mucin, Episialin, H23AG, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-associated Epithelial Membrane Antigen, EMA, Tumor-ass
MBS6212642-01 0.1 mL

Mucin 1 (MUC1, Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Carcinoma-associated Mucin, Episialin, H23AG, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-associated Epithelial Membrane Antigen, EMA, Tumor-ass

Sign In for Pricing
View Details