Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC198 Rabbit Polyclonal Antibody (HRP)

CCDC198 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C14orf105

UniProt

Q9NVL8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C14orf105

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WKIGKMETWLHEQEAQGQLLWDSSSSDSDEQGKDEKKPRALVRTRTERIP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060638

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNLL1 Antibody - middle region : FITC (ARP51261_P050-FITC)
ARP51261_P050-FITC 100 µL

DYNLL1 Antibody - middle region : FITC (ARP51261_P050-FITC)

Sign In for Pricing
View Details
PPEF1 (PPEF-1, Serine/Threonine Protein Phosphatase with EF-hands-1, Protein Phosphatase with EF Calcium-binding Domain, PPEF, Serine/Threonine-protein Phosphatase 7, PP7, PPEF, PPP7C) (MaxLight 550)
MBS6390292-01 0.1 mL

PPEF1 (PPEF-1, Serine/Threonine Protein Phosphatase with EF-hands-1, Protein Phosphatase with EF Calcium-binding Domain, PPEF, Serine/Threonine-protein Phosphatase 7, PP7, PPEF, PPP7C) (MaxLight 550)

Sign In for Pricing
View Details
PPEF1 (PPEF-1, Serine/Threonine Protein Phosphatase with EF-hands-1, Protein Phosphatase with EF Calcium-binding Domain, PPEF, Serine/Threonine-protein Phosphatase 7, PP7, PPEF, PPP7C) (MaxLight 550)
MBS6390292-02 5x 0.1 mL

PPEF1 (PPEF-1, Serine/Threonine Protein Phosphatase with EF-hands-1, Protein Phosphatase with EF Calcium-binding Domain, PPEF, Serine/Threonine-protein Phosphatase 7, PP7, PPEF, PPP7C) (MaxLight 550)

Sign In for Pricing
View Details
(R) -1- (4-Chlorophenyl) -2-methylpropan-1-amine (hydrochloride)
OR1037433-01 100 mg

(R) -1- (4-Chlorophenyl) -2-methylpropan-1-amine (hydrochloride)

Sign In for Pricing
View Details
(R) -1- (4-Chlorophenyl) -2-methylpropan-1-amine (hydrochloride)
OR1037433-02 250 mg

(R) -1- (4-Chlorophenyl) -2-methylpropan-1-amine (hydrochloride)

Sign In for Pricing
View Details
KDELR2 (NM_006854) Human Untagged Clone
SC115813 10 µg

KDELR2 (NM_006854) Human Untagged Clone

Sign In for Pricing
View Details