Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VRTN Rabbit Polyclonal Antibody (HRP)

VRTN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Vertnin, C14orf115

UniProt

Q9H8Y1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human VRTN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGQEAEEKQEKEAGRDVTAVMAPPVGASSEDVEGGPSREGALQEGATAQG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_060698

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3257804 1.0 µg DNA

Morn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human PTGES Knockout HEK293T cell line
GTR15415107 1 Vial

Human PTGES Knockout HEK293T cell line

Sign In for Pricing
View Details
C1r (NM_001134555) Rat Tagged Lenti ORF Clone
RR208367L3 10 µg

C1r (NM_001134555) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cyp2d3 siRNA Oligos set (Rat)
17402176 3x 5 nmol

Cyp2d3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Human Granulocyte Chemotactic Protein 2 (GCP2) CLIA Kit
MBS2025378-01 24 Strip Well

Human Granulocyte Chemotactic Protein 2 (GCP2) CLIA Kit

Sign In for Pricing
View Details
Human Granulocyte Chemotactic Protein 2 (GCP2) CLIA Kit
MBS2025378-02 48 Well

Human Granulocyte Chemotactic Protein 2 (GCP2) CLIA Kit

Sign In for Pricing
View Details