Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM143 Rabbit Polyclonal Antibody (HRP)

TMEM143 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96AN5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEM143

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTFNGTRALAHLQALTPSMGLYPPPGFPKLDPVAPITSEPPQATPSSNIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_060743

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1114705 3x 1.0 µg

KAT5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ELISA Kit For Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
E5464h 96 Tests

ELISA Kit For Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Coxsackie And Adenovirus Receptor Like Membrane Protein (CLMP)
MBS2085748-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Coxsackie And Adenovirus Receptor Like Membrane Protein (CLMP)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Coxsackie And Adenovirus Receptor Like Membrane Protein (CLMP)
MBS2085748-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Coxsackie And Adenovirus Receptor Like Membrane Protein (CLMP)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Coxsackie And Adenovirus Receptor Like Membrane Protein (CLMP)
MBS2085748-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Coxsackie And Adenovirus Receptor Like Membrane Protein (CLMP)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Coxsackie And Adenovirus Receptor Like Membrane Protein (CLMP)
MBS2085748-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Coxsackie And Adenovirus Receptor Like Membrane Protein (CLMP)

Sign In for Pricing
View Details