Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD10 Rabbit Polyclonal Antibody (FITC)

ABHD10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9NUJ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ABHD10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVGSSLGGW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060864

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin 8 Rabbit Monoclonal Antibody
E10G22573 100 µL

Septin 8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rat Hepatocyte Growth Factor (HGF) Antibody Pair Kit (with Standard)
MBS2098288-01 5x 96 Tests

Rat Hepatocyte Growth Factor (HGF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Hepatocyte Growth Factor (HGF) Antibody Pair Kit (with Standard)
MBS2098288-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Hepatocyte Growth Factor (HGF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Hepatocyte Growth Factor (HGF) Antibody Pair Kit (with Standard)
MBS2098288-03 10x 96 Tests

Rat Hepatocyte Growth Factor (HGF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Hepatocyte Growth Factor (HGF) Antibody Pair Kit (with Standard)
MBS2098288-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Hepatocyte Growth Factor (HGF) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Cd84 (NM_013489) Mouse Recombinant Protein
PM43732M5 20 µg

Cd84 (NM_013489) Mouse Recombinant Protein

Sign In for Pricing
View Details