Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCBP3 Rabbit Polyclonal Antibody (FITC)

NCBP3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ELG, C17orf85, HSA277841

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C17orf85

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSSDVHSRLGVPRQDSKGLYADTREKKSGNLWTRLGSAPKTKEKNTKKVD

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF740 conjugate, 0.1mg/mL
BNC742156-500 1x 500 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rosmarinic Acid
TRC-R684800-50MG 50 mg

Rosmarinic Acid

Sign In for Pricing
View Details
Destrin (DSTN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]
TA502661BM 100 µL

Destrin (DSTN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C5]

Sign In for Pricing
View Details
HLA Class II DR Mouse Monoclonal Antibody [Clone ID: BRA30]
AM39032FC-N 100 Tests

HLA Class II DR Mouse Monoclonal Antibody [Clone ID: BRA30]

Sign In for Pricing
View Details
Norbixin
TRC-N661120-50MG 50 mg

Norbixin

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3129R), CF640R conjugate, 0.1mg/mL
BNC403129-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3129R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details