Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCBP3 Rabbit Polyclonal Antibody (HRP)

NCBP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ELG, C17orf85, HSA277841

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C17orf85

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSSDVHSRLGVPRQDSKGLYADTREKKSGNLWTRLGSAPKTKEKNTKKVD

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD371 Antibody (FITC)
orb3012963 100 Tests

CD371 Antibody (FITC)

Sign In for Pricing
View Details
Lentiviral mouse Foxp1 shRNA (UAS) - Lentiviral mouseFoxp1 shRNA (UAS, GFP) (25)
GTR15162092 1 Vial

Lentiviral mouse Foxp1 shRNA (UAS) - Lentiviral mouseFoxp1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
(+)-alpha-Lipoic acid
MBS3842279-01 500 mg

(+)-alpha-Lipoic acid

Sign In for Pricing
View Details
(+)-alpha-Lipoic acid
MBS3842279-02 1 g

(+)-alpha-Lipoic acid

Sign In for Pricing
View Details
(+)-alpha-Lipoic acid
MBS3842279-03 5x 1 g

(+)-alpha-Lipoic acid

Sign In for Pricing
View Details
PPP1R14D discontinued
345437-01 100 µL

PPP1R14D discontinued

Sign In for Pricing
View Details