Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP1AR Rabbit Polyclonal Antibody (Biotin)

AP1AR Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

2C18, GBAR, C4orf16, PRO0971, gamma-BAR

UniProt

Q63HQ0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP1AR

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061039

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Cyclophilin E/PPIase E/PPIE (N-6His)
C216-1mg 1 mg

Recombinant Human Cyclophilin E/PPIase E/PPIE (N-6His)

Sign In for Pricing
View Details
Otogl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3154106 1.0 µg DNA

Otogl sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
RNF12 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-9177R-BF555 100 µL

RNF12 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
CIAPIN1 (Anamorsin, Cytokine-induced Apoptosis Inhibitor 1, Fe-S Cluster Assembly Protein DRE2 Homolog, 2810413N20Rik, DRE2, CUA001, PRO0915) APC
MBS6135903-01 0.1 mL

CIAPIN1 (Anamorsin, Cytokine-induced Apoptosis Inhibitor 1, Fe-S Cluster Assembly Protein DRE2 Homolog, 2810413N20Rik, DRE2, CUA001, PRO0915) APC

Sign In for Pricing
View Details
CIAPIN1 (Anamorsin, Cytokine-induced Apoptosis Inhibitor 1, Fe-S Cluster Assembly Protein DRE2 Homolog, 2810413N20Rik, DRE2, CUA001, PRO0915) APC
MBS6135903-02 5x 0.1 mL

CIAPIN1 (Anamorsin, Cytokine-induced Apoptosis Inhibitor 1, Fe-S Cluster Assembly Protein DRE2 Homolog, 2810413N20Rik, DRE2, CUA001, PRO0915) APC

Sign In for Pricing
View Details
Bovine Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit
DLR-CD40L-b-01 48 Tests

Bovine Cluster Of Differentiation 40 Ligand (CD40L) ELISA Kit

Sign In for Pricing
View Details