Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFAF7 Rabbit Polyclonal Antibody (HRP)

NDUFAF7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MidA, C2orf56, PRO1853

UniProt

Q7L592

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NDUFAF7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLMNPKKMGE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001077415

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A SH
HA50056004.0.1G 1 g

Polystyrene A SH

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF640R conjugate, 0.1mg/mL
BNC400532-100 1x 100 µL

Cytokeratin 14 (KRT14/532), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF640R conjugate, 0.1mg/mL
BNC403439-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (197-2B1), CF640R conjugate, 0.1mg/mL
BNC400931-100 1x 100 µL

CD46 (197-2B1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Bcl-2 Antibody Pair Set
E-KAB-0497 50 µL & 100 µg

Human Bcl-2 Antibody Pair Set

Sign In for Pricing
View Details
Water Chiller BCHI-206
BCHI-206 Each

Water Chiller BCHI-206

Sign In for Pricing
View Details