Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABL6 Rabbit Polyclonal Antibody (FITC)

RABL6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PARF, RBEL1, pp8875, C9orf86

UniProt

Q3YEC7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RABL6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001167460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Interleukin 17C (IL17C) ELISA Kit-Sandwich
EK10F717-01 48 Test

Canine Interleukin 17C (IL17C) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Canine Interleukin 17C (IL17C) ELISA Kit-Sandwich
EK10F717-02 96 Tests

Canine Interleukin 17C (IL17C) ELISA Kit-Sandwich

Sign In for Pricing
View Details
DcR3, NT (TR6, Decoy Receptor 3, TNFRSF6B, TR6, M68) (MaxLight 750) discontinued
D1500-25M-ML750 100 µL

DcR3, NT (TR6, Decoy Receptor 3, TNFRSF6B, TR6, M68) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Chicken Aromatic-L-amino-acid decarboxylase (DDC) ELISA Kit
MBS7214726-01 48 Well

Chicken Aromatic-L-amino-acid decarboxylase (DDC) ELISA Kit

Sign In for Pricing
View Details
Chicken Aromatic-L-amino-acid decarboxylase (DDC) ELISA Kit
MBS7214726-02 96 Well

Chicken Aromatic-L-amino-acid decarboxylase (DDC) ELISA Kit

Sign In for Pricing
View Details
Chicken Aromatic-L-amino-acid decarboxylase (DDC) ELISA Kit
MBS7214726-03 5x 96 Well

Chicken Aromatic-L-amino-acid decarboxylase (DDC) ELISA Kit

Sign In for Pricing
View Details