Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COA1 Rabbit Polyclonal Antibody (FITC)

COA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C7orf44, MITRAC15

UniProt

Q9GZY4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human COA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_060694

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Laptm4a shRNA (UAS) - Lentiviral mouse Laptm4a shRNA (UAS, RFP) plasmid
GTR15276841 1 Vial

Lentiviral mouse Laptm4a shRNA (UAS) - Lentiviral mouse Laptm4a shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TBX3 (T-Box 3, TBX3-ISO, UMS, XHL) (HRP)
252442-HRP 100 µL

TBX3 (T-Box 3, TBX3-ISO, UMS, XHL) (HRP)

Sign In for Pricing
View Details
Bovine Linker For Activation of T-Cell ELISA Kit
OM620145 96 Strip Well

Bovine Linker For Activation of T-Cell ELISA Kit

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein/NP Polyclonal Antibody
MBS2563776-01 0.05 mL

Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein/NP Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein/NP Polyclonal Antibody
MBS2563776-02 0.1 mL

Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein/NP Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein/NP Polyclonal Antibody
MBS2563776-03 5x 0.1 mL

Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein/NP Polyclonal Antibody

Sign In for Pricing
View Details