Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA12 Rabbit Polyclonal Antibody (HRP)

NDUFA12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B17.2, DAP13, MC1DN23

UniProt

Q9UI09

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFA12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061326

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (LK2H10 + PHE5 + CGA414), 0.2mg/mL
BNUB1223-500 1x 500 µL

Chromogranin A (LK2H10 + PHE5 + CGA414), 0.2mg/mL

Sign In for Pricing
View Details
Human AHRR activation kit by CRISPRa
GA111532 1 Kit

Human AHRR activation kit by CRISPRa

Sign In for Pricing
View Details
GMP Human Flt-3 Ligand Protein
GMP-FLLH28-500ug 500 µg

GMP Human Flt-3 Ligand Protein

Sign In for Pricing
View Details
Recombinant Human CD153/CD30L/TNFSF8 Protein
PKSH030309 200 µg

Recombinant Human CD153/CD30L/TNFSF8 Protein

Sign In for Pricing
View Details
GRTP1 Rabbit Polyclonal Antibody
TA361047 100 µL

GRTP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LAMP2 (NM_002294) Human Recombinant Protein
TP321216 20 µg

LAMP2 (NM_002294) Human Recombinant Protein

Sign In for Pricing
View Details