Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YAE1 Rabbit Polyclonal Antibody (Biotin)

YAE1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CIAB2, GK003, YAE1D1, C7orf36

UniProt

Q9NRH1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human YAE1D1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_064577

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS2 ORF Vector (Human) (pORF)
18183012 1.0 µg DNA

DHRS2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila bioD Protein (aa 1-212) (strain Paris)
VAng-Lsx04282-500gEcoli 500 µg (E. coli)

Recombinant Legionella Pneumophila bioD Protein (aa 1-212) (strain Paris)

Sign In for Pricing
View Details
TASK-5/KCNK15 Overexpression Lysate (Native) - (Dry Ice)
NBP2-06440 0.1 mg

TASK-5/KCNK15 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Kcnj11 (ATP-sensitive inward rectifier potassium channel 11, BIR, Inward rectifier K (+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (PE) discontinued
K1870-01-PE 100 µL

Kcnj11 (ATP-sensitive inward rectifier potassium channel 11, BIR, Inward rectifier K (+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11) (PE) discontinued

Sign In for Pricing
View Details
Fuk AAV siRNA Pooled Vector
21064166 1.0 µg

Fuk AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Tspan9 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4751302 1.0 µg DNA

Tspan9 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details