Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YAE1 Rabbit Polyclonal Antibody (HRP)

YAE1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CIAB2, GK003, YAE1D1, C7orf36

UniProt

Q9NRH1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human YAE1D1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SHVVDLLDSIEDMDLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_064577

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human UCHL1 Antibody (SAb2426)
RHC44506 100 μg

Anti-Human UCHL1 Antibody (SAb2426)

Sign In for Pricing
View Details
KSR2 (Kinase Suppressor of Ras 2, Kinase Suppressor of Ras-2, FLJ25965) (FITC)
207755-FITC 100 µL

KSR2 (Kinase Suppressor of Ras 2, Kinase Suppressor of Ras-2, FLJ25965) (FITC)

Sign In for Pricing
View Details
Anti-Human CD314/KLRK1 Antibody (SAA0098), APC
FHD72113 100 Tests

Anti-Human CD314/KLRK1 Antibody (SAA0098), APC

Sign In for Pricing
View Details
Genesig Turkey Meat Speciation Kit, Easy discontinued
366804 1 Kit

Genesig Turkey Meat Speciation Kit, Easy discontinued

Sign In for Pricing
View Details
Recombinant Guillardia theta Photosystem I iron-sulfur center (psaC)
MBS1256781-01 0.02 mg (E-Coli)

Recombinant Guillardia theta Photosystem I iron-sulfur center (psaC)

Sign In for Pricing
View Details
Recombinant Guillardia theta Photosystem I iron-sulfur center (psaC)
MBS1256781-02 0.1 mg (E-Coli)

Recombinant Guillardia theta Photosystem I iron-sulfur center (psaC)

Sign In for Pricing
View Details