Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc47 Rabbit Polyclonal Antibody (Biotin)

Ccdc47 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A, cal, asp4, C88307, calumin, 2610204L23Rik

UniProt

Q9D024

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ccdc47

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080285

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

KU70 Polyclonal Antibody
RD80148A-01 60 μL

KU70 Polyclonal Antibody

Sign In for Pricing
View Details
KU70 Polyclonal Antibody
RD80148A-02 120 μL

KU70 Polyclonal Antibody

Sign In for Pricing
View Details
KU70 Polyclonal Antibody
RD80148A-03 200 µL

KU70 Polyclonal Antibody

Sign In for Pricing
View Details
TRIP12 3'UTR GFP Stable Cell Line
TU076615 1.0 mL

TRIP12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CD42b (Platelet Glycoprotein Ib alpha Chain, GP-Ib alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Antigen CD42b-alpha, GP1BA, MGC34595) APC
MBS6373082-01 0.1 mL

CD42b (Platelet Glycoprotein Ib alpha Chain, GP-Ib alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Antigen CD42b-alpha, GP1BA, MGC34595) APC

Sign In for Pricing
View Details
CD42b (Platelet Glycoprotein Ib alpha Chain, GP-Ib alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Antigen CD42b-alpha, GP1BA, MGC34595) APC
MBS6373082-02 5x 0.1 mL

CD42b (Platelet Glycoprotein Ib alpha Chain, GP-Ib alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Antigen CD42b-alpha, GP1BA, MGC34595) APC

Sign In for Pricing
View Details