Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdzd4 Rabbit Polyclonal Antibody (Biotin)

Pdzd4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LU, Xl, LU1, PDZ, Xlu, PDZD, Pdzk, Pdzr, Pdzk4, PDZRN4L, Pdzrnk4l, B230341P03, Kiaa1444-hp, D130075J17Rik

UniProt

Q9QY39

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pdzd4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKPE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001025039

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCCC2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1278305 3x 1.0 µg

MCCC2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
USE1 Antibody
43550 100 µL

USE1 Antibody

Sign In for Pricing
View Details
Lrrc42 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3553705 3x 1.0 µg

Lrrc42 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
In Vivo Recombinant Monoclonal Anti- Mouse PD-1 antibody (Clone RMP1-14.1), Rat IgG2a Kappa
BVA1001-3 25 mg

In Vivo Recombinant Monoclonal Anti- Mouse PD-1 antibody (Clone RMP1-14.1), Rat IgG2a Kappa

Sign In for Pricing
View Details
ELISA Kit For Ephrin type-A receptor 3
E1114r 96 Tests

ELISA Kit For Ephrin type-A receptor 3

Sign In for Pricing
View Details
PHPT1 Rabbit Polyclonal Antibody
orb629893-01 50 µg

PHPT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details