Pdzd4 Rabbit Polyclonal Antibody (FITC)
Pdzd4 Rabbit Polyclonal Antibody (FITC)
Product Specifications
Product Name Alternative
LU, Xl, LU1, PDZ, Xlu, PDZD, Pdzk, Pdzr, Pdzk4, PDZRN4L, Pdzrnk4l, B230341P03, Kiaa1444-hp, D130075J17Rik
UniProt
Q9QY39
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pdzd4
Clonality
Polyclonal
Conjugation
FITC
Sequence
Synthetic peptide located within the following region: SEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKPE
Purification
Affinity Purified
Form
Liquid. Purified antibody supplied in 1x PBS buffer.
Molecular Weight
86kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat
Tested Applications
WB
NCBI Accession Number
NP_001025039
Host or Source
Rabbit
Preservative
Liquid. Purified antibody supplied in 1x PBS buffer.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
168818-01 20 µg
Ku (p70/p80) (Ku (p70) : 70kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, CTC75, CTCBF, DNA repair protein XRCC6, G22P1, Ku autoantigen, 70kD, Ku70, Kup70, Lupus Ku autoantigen protein p70, ML8, Thyroid autoantigen 70kD (Ku antigen), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 6 (XRCC6) Ku (p80) : 86kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 2, ATP dependent DNA helicase II 86kD subunit, ATP-dependent DNA helicase II 80kD subunit, CTC box-binding factor 85kDa subunit, CTC85, CTCBF, DNA repair protein XRCC5, KARP1, Ku autoantigen 80kD, Ku80, Ku86 autoantigen related protein 1, KUB2, Lupus Ku autoantigen protein p86, Nuclear factor IV (NFIV), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 5 (XRCC5) )
Sign In for Pricing
View Details 168818-02 100 µg
Ku (p70/p80) (Ku (p70) : 70kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, CTC75, CTCBF, DNA repair protein XRCC6, G22P1, Ku autoantigen, 70kD, Ku70, Kup70, Lupus Ku autoantigen protein p70, ML8, Thyroid autoantigen 70kD (Ku antigen), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 6 (XRCC6) Ku (p80) : 86kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 2, ATP dependent DNA helicase II 86kD subunit, ATP-dependent DNA helicase II 80kD subunit, CTC box-binding factor 85kDa subunit, CTC85, CTCBF, DNA repair protein XRCC5, KARP1, Ku autoantigen 80kD, Ku80, Ku86 autoantigen related protein 1, KUB2, Lupus Ku autoantigen protein p86, Nuclear factor IV (NFIV), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 5 (XRCC5) )
Sign In for Pricing
View Details 
