Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSWIM5 Rabbit Polyclonal Antibody (HRP)

ZSWIM5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9P217

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZSWIM5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ISPRHYGEFIEFLSKARETFLLPQDGHLQFAQFIDNLKQIYKGKKKLMLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

130kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065934

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFNG Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
28447061 1.0 µg DNA

MFNG Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
NMDAR2C Rabbit pAb, IRDye 800CW conjugated
orb2825601 100 µL

NMDAR2C Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Collagen IX Rabbit Polyclonal Antibody (Cy5)
orb939281 100 µL

Collagen IX Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Huntingtin (HTT) (NM_002111) Human Recombinant Protein
E45H35186M5 20 µg

Huntingtin (HTT) (NM_002111) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human MOB Kinase Activator 1A/MOB1A (C-6His)
AP75029-01 10 µg

Recombinant Human MOB Kinase Activator 1A/MOB1A (C-6His)

Sign In for Pricing
View Details
Recombinant Human MOB Kinase Activator 1A/MOB1A (C-6His)
AP75029-02 50 µg

Recombinant Human MOB Kinase Activator 1A/MOB1A (C-6His)

Sign In for Pricing
View Details