Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC81 Rabbit Polyclonal Antibody (HRP)

CCDC81 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZN84

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC81

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKAFERASDKLFLLDQCEKYRRCKQCQRRTSNVGESNLWPLNKFLPGSRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001149946

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TICAM1 sgRNA gene knockout kit - Lentiviral human TICAM1 sgRNA gene knockout kit (25)
GTR15360108 1 Vial

Lentiviral human TICAM1 sgRNA gene knockout kit - Lentiviral human TICAM1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
RGD1559891 3'UTR GFP Stable Cell Line
TU268101 1.0 mL

RGD1559891 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LRIG1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1229105 3x 1.0 µg

LRIG1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: UMAB164]
UM500106 100 µL

CD31 (PECAM1) Mouse Monoclonal Antibody [Clone ID: UMAB164]

Sign In for Pricing
View Details
PCDH7 Mouse mAb
C06385-20uL 20 µL

PCDH7 Mouse mAb

Sign In for Pricing
View Details
MCM5 Mouse Monoclonal Antibody (HRP)
orb2602910 100 µg

MCM5 Mouse Monoclonal Antibody (HRP)

Sign In for Pricing
View Details